Protein Info for IAI47_04945 in Pantoea sp. MT58

Annotation: two-component system response regulator GlrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF00072: Response_reg" amino acids 10 to 118 (109 residues), 105.3 bits, see alignment E=4.1e-34 PF00158: Sigma54_activat" amino acids 137 to 303 (167 residues), 242.5 bits, see alignment E=4e-76 PF14532: Sigma54_activ_2" amino acids 139 to 308 (170 residues), 71.2 bits, see alignment E=2.2e-23 PF07728: AAA_5" amino acids 161 to 278 (118 residues), 30.3 bits, see alignment E=8e-11

Best Hits

Swiss-Prot: 84% identical to GLRR_ECOLI: Transcriptional regulatory protein GlrR (glrR) from Escherichia coli (strain K12)

KEGG orthology group: K07715, two-component system, NtrC family, response regulator YfhA (inferred from 99% identity to pva:Pvag_2302)

Predicted SEED Role

"Putative sensory histidine kinase YfhA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>IAI47_04945 two-component system response regulator GlrR (Pantoea sp. MT58)
MMVRQAAKLLLVDDDPSLLKLLGMRLRSEGYQVTTAGSGPEALRLLQKEKIELVISDLRM
DEMDGLALFGEIQKRHTGLPVIILTAHGSIPDAVSATQQGVFSFLTKPVDRDALYKAIDE
ALAQQAPVSDDRWREAIVTRSPLMLKLLEQAHMVAQSDVSVLINGQSGTGKEMLAQAIHA
ASPRNGKPFVAINCGALPEQLLESELFGHAKGAFTGAVSAREGLFKAAGGGTLFLDEIGD
MPQPLQVKLLRVLQERKVRPLGSDHDSEIDVRIISATHRDLPKAMEKKEFREDLFYRLNV
VNLKIPALHQRTEDIPLLANHLLRQAAERHKPQIRSFSVDAMKRLMAASWPGNVRQLVNV
IEQCVALSSSPVISDALVEQALSGENSALPTFAEARNQFELNYLRKLLQMTKGNVTNAAR
LAGRNRTEFYKLLSRHELDASDFKE