Protein Info for IAI47_04920 in Pantoea sp. MT58
Annotation: tRNA adenosine(34) deaminase TadA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 78% identical to TADA_SALTY: tRNA-specific adenosine deaminase (tadA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: None (inferred from 96% identity to pva:Pvag_2307)MetaCyc: 76% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-
Predicted SEED Role
"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.5.4.-
Use Curated BLAST to search for 3.5.4.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (163 amino acids)
>IAI47_04920 tRNA adenosine(34) deaminase TadA (Pantoea sp. MT58) MKQQDEYWMRHALGLARRAWEQSEVPVGAVLVQNDQVIGEGWNRPIGQHDPTAHAEIMAL RQGGKVLENYRLLDTTLYVTLEPCVMCAGAMVHSRITRLVYGAHDVKSGAAGSLLDVLGH PGMNHQIELHSGVLAEECAAMLSDFFRMRREQKKALRQAQRQG