Protein Info for IAI47_04850 in Pantoea sp. MT58

Annotation: RNA polymerase sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR02939: RNA polymerase sigma factor RpoE" amino acids 1 to 189 (189 residues), 327.1 bits, see alignment E=4e-102 PF07638: Sigma70_ECF" amino acids 10 to 183 (174 residues), 26.7 bits, see alignment E=9.5e-10 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 23 to 183 (161 residues), 98.9 bits, see alignment E=2.5e-32 PF04542: Sigma70_r2" amino acids 25 to 91 (67 residues), 63 bits, see alignment E=3.6e-21 PF08281: Sigma70_r4_2" amino acids 131 to 180 (50 residues), 68.7 bits, see alignment E=5.3e-23 PF04545: Sigma70_r4" amino acids 135 to 180 (46 residues), 37 bits, see alignment E=3.9e-13

Best Hits

Swiss-Prot: 95% identical to RPOE_SALT1: ECF RNA polymerase sigma-E factor (rpoE) from Salmonella typhimurium (strain 14028s / SGSC 2262)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 95% identity to eck:EC55989_2862)

MetaCyc: 95% identical to RNA polymerase sigma factor RpoE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>IAI47_04850 RNA polymerase sigma factor RpoE (Pantoea sp. MT58)
MSEQLTDQVLVERVQKGDQKSFNLLVIRYQHKVASLVSRYVPSGDVPDVVQESFIKAYRA
LDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDAIDAENFESAGALKEISNPEN
LMLSDELKQIVFRTIEALPEDLRMAITLRELDGLSYEEIAVIMDCPVGTVRSRIFRAREA
IDNKVQPLIQR