Protein Info for IAI47_04830 in Pantoea sp. MT58

Annotation: autonomous glycyl radical cofactor GrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04365: autonomous glycyl radical cofactor GrcA
  • amino acids 2 to 127 (126 residues), 236.2 bits, E=4.4e-75
• PF01228: Gly_radical
  • amino acids 12 to 108 (97 residues), 67.8 bits, E=5.5e-23

Best Hits

Swiss-Prot: 82% identical to GRCA_PECAS: Autonomous glycyl radical cofactor (grcA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K06866, autonomous glycyl radical cofactor (inferred from 97% identity to pva:Pvag_2326)

MetaCyc: 83% identical to stress-induced alternate pyruvate formate-lyase subunit (Escherichia coli K-12 substr. MG1655)
Formate C-acetyltransferase. [EC: 2.3.1.54]; 2.3.1.54 [EC: 2.3.1.54]

Predicted SEED Role

"Pyruvate formate-lyase (EC 2.3.1.54)" in subsystem Butanol Biosynthesis or Fermentations: Mixed acid (EC 2.3.1.54)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (17/19 steps found)
• mixed acid fermentation (14/16 steps found)
• superpathway of N-acetylneuraminate degradation (18/22 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-threonine degradation I (6/6 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• reductive monocarboxylic acid cycle (1/2 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.54

Use Curated BLAST to search for 2.3.1.54

Protein Sequence (127 amino acids)

>IAI47_04830 autonomous glycyl radical cofactor GrcA (Pantoea sp. MT58)
MITGIQITQSNNSQLLNSFWLLDEEKAQARCLCAKAGYEEDQVVALSELGEFAWREVPVE
IKPQVRVEGGQHLNVNVLRRETLEDAVKHPENYPQLTIRVSGYAVRFNSLTPEQQRDVIT
RTFTESL