Protein Info for IAI47_04675 in Pantoea sp. MT58

Annotation: oxalate/formate MFS antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 298 to 315 (18 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details TIGR04259: oxalate/formate antiporter" amino acids 15 to 419 (405 residues), 406.6 bits, see alignment E=5.5e-126 PF07690: MFS_1" amino acids 35 to 268 (234 residues), 75 bits, see alignment E=5.4e-25 amino acids 236 to 408 (173 residues), 61.9 bits, see alignment E=5.4e-21

Best Hits

KEGG orthology group: None (inferred from 94% identity to pva:Pvag_2335)

Predicted SEED Role

"FIG00732331: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>IAI47_04675 oxalate/formate MFS antiporter (Pantoea sp. MT58)
MTSISEPVVIAKHSKWVQLLLGLICMAAISSPQYVWTLLTKPMIAKLGVGLAELQVTFSL
LIILQTFFSPFQGRLVERFGPRLLISIGTLMAGFSWVIAARVDSLTALYLVYGCLGGLGT
GIVYIGVVGLVMKWFPQQRGFAAGTVAAGYGMGAIFTTFPISISLNSYGLEQTMTTFGLI
FAAVGLLASQNLRLPESSAMMPVSNTSSPVRGQRQFKSREMLRQPLFWLMFMMMTMMSTS
GLMVTSQMAIFAEDFGISKAVVFGMAALPLALTIDRFTNGLTRPLFGFISDRYGRENTMF
IAFALEGVAMTLWLACREDPVLFVLLSGVVFFGWGEIFSLFPSTLTDTFGSENASTNYGW
LYMSQGIGSIFGGPLAALMYQHTHNWHLVFGCAITFDFITAGLALWVLKPWRARFMHAQN
NRAH