Protein Info for IAI47_04670 in Pantoea sp. MT58

Annotation: catecholate siderophore receptor CirA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07715: Plug" amino acids 51 to 159 (109 residues), 114.7 bits, see alignment E=4.3e-37 PF00593: TonB_dep_Rec" amino acids 212 to 630 (419 residues), 204.6 bits, see alignment E=8.1e-64 PF14905: OMP_b-brl_3" amino acids 388 to 644 (257 residues), 37.9 bits, see alignment E=1.8e-13

Best Hits

Swiss-Prot: 68% identical to CIRA_ECOLI: Colicin I receptor (cirA) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 71% identity to ebi:EbC_29920)

Predicted SEED Role

"Colicin I receptor precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (657 amino acids)

>IAI47_04670 catecholate siderophore receptor CirA (Pantoea sp. MT58)
MVKTNFTPAVKAGLFAQLITATMPVMAEEASEVKENEDQMVVTASSVEQNLKDAPASISV
ITREDLQRKPVQNLKEVLKDVPGVQLTNESDNRQGVSIRGLGSSYTLILVDGKRVNSRNA
VFRHNDFDLSWIPAESIERIEVVRGPMSSLYGSDALGGVVNIITRKVGTQWHGTLSADTT
VQEHRDRGDSGNGNFFASGPLVDDLLGVKVYGALGKRNKDQASSASGSTGQPRIEGYTSR
NANVEFSLTPDKDQDITFGYGMDRQDRDSDTLDKNRIERENYSLGHAGRWGVANTELRFY
GEKIENKNAKTITSKNNSLDGKVVIPLGDYTQFLTFGGEYRNDKLEDAVNMKNGGSVQAN
QYALFLEDEWHIFENLTLTGGVRMDDHENYGVNWSPRAYLVYNATDTVTLKGGWASAFKA
PSLLQLSPDWLSGSCRGSCNVVGNKDLKAETSESMEFGLYYAGQRGWLEDVTASATVFQN
DIDDMITVIRTANRSLAPSYPNFAGFDASGNPIFRYYNVNKARIRGLETELGLPVADKLN
LRLNYTYNDARDLSNGGNKPLSELPFHTTNATLDWKPLEDWSFYLSANYKGKSRTVTDGN
ATPGGYTTWNTGGSYQVNKAVKIRAGVLNLTDKDLNRDDYSYNEDGRRYFAAVDYSF