Protein Info for IAI47_04660 in Pantoea sp. MT58

Annotation: DeoR/GlpR transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF08220: HTH_DeoR" amino acids 6 to 62 (57 residues), 62.6 bits, see alignment E=2.3e-21 PF00455: DeoRC" amino acids 87 to 244 (158 residues), 159.6 bits, see alignment E=6.3e-51

Best Hits

KEGG orthology group: K02430, DeoR family transcriptional regulator, L-fucose operon activator (inferred from 84% identity to pam:PANA_2786)

Predicted SEED Role

"L-fucose operon activator" in subsystem L-fucose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>IAI47_04660 DeoR/GlpR transcriptional regulator (Pantoea sp. MT58)
MLPIERQQRIINEININGRVIVSELVTLCQVSQETIRRDLSQLEKRGLLQRSHGGAVLIK
KQNTGTQGNSRIANQSELTFRQRINEHVDEKMIIAKRALDFISPGDCILLDSSTTCWYLA
RQLPDIELTVLTNSLRIVQTLAARGSIRTICLGGEYSDRDEAFHGVVAEQPLREFQINKI
FFSCSSLGNDGYLREGNENNAHLKQQMLLAAEKKHLLMDGSKFLRPSFARICHYRDVDFL
ITDQLKDKELEQELAWNGVNVIVCSQRYQSMQLIKN