Protein Info for IAI47_04650 in Pantoea sp. MT58

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 PF00005: ABC_tran" amino acids 25 to 177 (153 residues), 101.8 bits, see alignment E=5.1e-33 amino acids 277 to 431 (155 residues), 88.3 bits, see alignment E=7.4e-29

Best Hits

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 87% identity to pam:PANA_2788)

Predicted SEED Role

"D-allose ABC transporter, ATPase component" in subsystem D-allose utilization

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>IAI47_04650 sugar ABC transporter ATP-binding protein (Pantoea sp. MT58)
MQEVTPQTLIALDNLSKTFGGNRALSDISLTLLAGEVHCLAGTNGCGKSTLIKVISGVHA
PDSGSRITLGDGAPLPRLTTRQARDFGIQVIYQDLSLFPNLSVAENIAFEHNLNGLLRWH
HRARLQESARSIINELKFDLNLDEKVAALSIAQRQQVAICRALVADARLVIMDEPTASLT
RTEVNQLLRTVRYLKDKNICVVFVSHRLDEVLEISDRVTVIRDGRKMGCWPAREMTPHHL
TELMTGLKLDYQLKAPTRNDNRAILEIEDLTRAGQYHNVNFKLYEGEVLGLCGLLGSGRT
ELALSLFGMTRPDSGKIWLDSKPVRFRGHEDAIKAGIGYVSEDRLTLGLVQQQSVADNMV
LPILDKLQNRFHLIDEYRKNKLILQWIQQLGVRVADPNLAISTLSGGNQQKIVLAKWVLT
QPRILILDSPTVGVDVGAKASIYQLIHELAKEGLSIILISDEVPEVWYNCDRILHFRDGT
IHAEYQPDSVEQQQLAEVINA