Protein Info for IAI47_04645 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 46 to 63 (18 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 256 to 287 (32 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 40 to 312 (273 residues), 107 bits, see alignment E=4.9e-35

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 84% identity to pwa:Pecwa_3722)

Predicted SEED Role

"D-allose ABC transporter, permease component" in subsystem D-allose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>IAI47_04645 ABC transporter permease (Pantoea sp. MT58)
MPDFSRFRPHSSQGWLAWVLLAFILFFSVASDQFLTMQNLLDLAESYAVTGIFALGLFVV
LVTGGIDISFAAVASVVQYLLASLFVQFQFDNALLSIVLAVMCGTLFGVINALLITTLRV
VSIIITISMQSLLFGLLMWVTGGRSLYSLPEWWITLRNVLPFSWQGESFQVGLPLVTMLL
IAAVTALLLNKTNLGRQLYAVGGDAESARRIGIRVGLIHVFAYGWLGAMAAIGGLVQVYR
MGEVVPNALVGGELDVLAATVLGGASLMGGKGTVSGTLMGVFLIAILKNGLNLVGVSNYF
MNIVVGGVIMIAIAVTHYKKRKETDVSFV