Protein Info for IAI47_04520 in Pantoea sp. MT58

Annotation: glycine betaine/L-proline ABC transporter permease ProW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 104 to 126 (23 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 200 to 227 (28 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 171 to 336 (166 residues), 96.6 bits, see alignment E=7.9e-32

Best Hits

Swiss-Prot: 84% identical to PROW_SALTY: Glycine betaine/proline betaine transport system permease protein ProW (proW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 84% identity to pam:PANA_2994)

MetaCyc: 82% identical to glycine betaine ABC transporter membrane subunit ProW (Escherichia coli K-12 substr. MG1655)
RXN-8638 [EC: 7.6.2.9]; 7.4.2.- [EC: 7.6.2.9]

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>IAI47_04520 glycine betaine/L-proline ABC transporter permease ProW (Pantoea sp. MT58)
MSQDTTNPWDSGTAASTQAAPTSSGGADAWGTPDGSATTHAASSSDWLNSARAPAPEHFS
IMDPFHKTWIPLDHWVTTGIDWVVNHFRPLFQGIRVPVDYILSAFQQLLLGMPAPVAILV
FALIAWQIATPAMGIATLVSLIAIGAIGAWSQAMVTLALVLTALMFCILIGLPLGIWLAR
SERAARIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ
VPADLIEASESFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ
MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQSFGRDSRSRGNRHWYHTGPLGLIFSPS
RKK