Protein Info for IAI47_04495 in Pantoea sp. MT58

Annotation: multidrug efflux MFS transporter permease subunit EmrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 335 to 352 (18 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 479 to 497 (19 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 12 to 497 (486 residues), 698.4 bits, see alignment E=2.5e-214 PF07690: MFS_1" amino acids 18 to 413 (396 residues), 188.7 bits, see alignment E=1.4e-59

Best Hits

Swiss-Prot: 88% identical to EMRB_ECO57: Multidrug export protein EmrB (emrB) from Escherichia coli O157:H7

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 98% identity to pva:Pvag_2364)

MetaCyc: 88% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>IAI47_04495 multidrug efflux MFS transporter permease subunit EmrB (Pantoea sp. MT58)
MAQKPLEGMPLVLMTVALSLATFMQVLDSTIANVAIPTIAGNLGASNSQGTWVITSFGVA
NAISIPLTGWLAKRIGEVKLFTWSTILFAIASWACGMSDSLEMLIFFRVIQGIVAGPLIP
LSQSLLLNNYPPAKRSLALSLWAMTVIVAPICGPILGGWISDNYHWGWIFFINVPIGVAV
VILTLQTLRGRETKTEIRRIDMVGLVLLVVGIGCLQVMLDRGKELDWFNSVEIIVLGVVA
LIALTVLLVWELTDDHPIIDLSLFKSRNFTIGCLSISLAYMLYFGSIVLLPQLLQEVYGY
TATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFSFIMYAICFYWRAYTFEPGMDF
GASAWPQFIQGFAVACFFMPLTTITLSGLPPERMAAASSLSNFMRTFAGSVGTSITTTMW
TNRESMHHSYMTESITPYNVNSQQMYSQLESLGMTQQQASAYIAQQITNQGLIISANEIF
WASAGVFLILLVLIWFARPPFGAGGGGGGAH