Protein Info for IAI47_04465 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 92 to 125 (34 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 402 to 420 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 20 to 217 (198 residues), 85.7 bits, see alignment E=6.6e-28 amino acids 220 to 420 (201 residues), 56.9 bits, see alignment E=3.6e-19 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 26 to 415 (390 residues), 469 bits, see alignment E=6.7e-145 PF07690: MFS_1" amino acids 52 to 380 (329 residues), 92 bits, see alignment E=7.4e-30 amino acids 255 to 422 (168 residues), 44.5 bits, see alignment E=2.1e-15 PF13347: MFS_2" amino acids 158 to 363 (206 residues), 29.5 bits, see alignment E=6.1e-11 PF12832: MFS_1_like" amino acids 259 to 415 (157 residues), 26.3 bits, see alignment E=8e-10

Best Hits

Swiss-Prot: 78% identical to KGTP_ECOLI: Alpha-ketoglutarate permease (kgtP) from Escherichia coli (strain K12)

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 97% identity to pva:Pvag_2371)

MetaCyc: 78% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"Alpha-ketoglutarate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>IAI47_04465 MFS transporter (Pantoea sp. MT58)
MTPTNNKTQPDDTKKRIWAIVGASSGNLVEWFDFYVYSFFSLYFAHIFFPKGDTTTQLLQ
TAGVFAAGFLMRPIGGWLFGYIGDKHGRKNSMLVSVCMMCFGSLVIACLPGYAAIGVAAP
VILLLARMFQGLSVGGEYGTSATYMSEVALEGRKGFYASFQYVTLIGGQLAAVLTVVVLQ
FVLTDAELRSWGWRIPFFLGALLAVVALWLRRSLEETSDKASREHRDAGSVIGLLRNHTR
PFLMVLGFTAGGSLSFYTFTTYMQKYLVNTSGMDPKTASGLMTGALLVFMLIQPIIGALS
DKIGRRTSMMIFGAGAAICTVPILTLLQNVQSPGVAFLLIMLALLITSFYTAISGILKAE
MFPPQVRALGVGLSYAVANALFGGSAEYVALLMKQQGIETTFFWYVSAMGAVAFLVSLLL
HRRGKGITL