Protein Info for IAI47_04250 in Pantoea sp. MT58

Annotation: NarK family nitrate/nitrite MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 348 to 376 (29 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details amino acids 437 to 458 (22 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 37 to 418 (382 residues), 354.8 bits, see alignment E=2.7e-110 PF07690: MFS_1" amino acids 47 to 377 (331 residues), 68.3 bits, see alignment E=3e-23

Best Hits

Swiss-Prot: 75% identical to NARK_ECOLI: Nitrate/nitrite transporter NarK (narK) from Escherichia coli (strain K12)

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 96% identity to pva:Pvag_2414)

MetaCyc: 75% identical to nitrate:nitrite antiporter NarK (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-239

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>IAI47_04250 NarK family nitrate/nitrite MFS transporter (Pantoea sp. MT58)
MTQSAPLQTPMRGALIQDWQPENEAFWQARGKRIASRNLWISVFCLLQGFCVWMLFSTVA
VNLNKVGFNFSTEQLFLLTALPSVSGALLRVPYSFVIPIFGGRRWTAFSTGILIIPCLWL
GFAVQDSQTSFTTFMVIALLCGFGGANFASSMGNISFFFPKARQGGALGINGGLGNLGVS
VMQFVAPLAISCAIFGFADTGHTTVTGDSIWLENAAWIWVPFLALGTLAAWFGMNDLAAA
KSSLREQLPVLKRPHLWVMALLYLATFGSFIGFSAGFAMLAKTQFPDVVIMHYAFFGPLI
GALARSAGGIISDRLGGTRVTLVNYILMALFTALLFLTLPGDGHDGSFIAFFAVFMGLFL
TSGLGSGSTYQMIAVLFRKLTLERIKAEGGDDAHAQREAGTETSAALGFISAIGALGGFF
IPQTFGLSLAMTGSPAGAMKIFLVFYLCCIAVTWLVYVRKARA