Protein Info for IAI47_04245 in Pantoea sp. MT58

Annotation: two-component system response regulator NarL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00072: Response_reg" amino acids 16 to 126 (111 residues), 99.3 bits, see alignment E=4.6e-32 PF04545: Sigma70_r4" amino acids 159 to 204 (46 residues), 28.4 bits, see alignment 2.8e-10 PF08281: Sigma70_r4_2" amino acids 159 to 203 (45 residues), 35.9 bits, see alignment 1.4e-12 PF00196: GerE" amino acids 161 to 216 (56 residues), 77.8 bits, see alignment E=1.1e-25 PF13412: HTH_24" amino acids 163 to 202 (40 residues), 26.6 bits, see alignment 1.1e-09 PF13384: HTH_23" amino acids 164 to 194 (31 residues), 26.9 bits, see alignment 1e-09

Best Hits

Swiss-Prot: 71% identical to NARL_ECOLI: Nitrate/nitrite response regulator protein NarL (narL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to pva:Pvag_2415)

MetaCyc: 71% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Nitrate/nitrite response regulator protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>IAI47_04245 two-component system response regulator NarL (Pantoea sp. MT58)
MTGTGAIVTDGKFTLLLIDDHPMLRSGLKQLIALDERLQVVAEAGNGIDGLTLAQLHDPD
LILLDLNMPGLNGLDTLTQLREIALSGRVVVFSVSDNEEDVISALKRGADGYLLKDMEPE
DLLKALHQAAAGQIVLSEALTPILVARLREAQPGQTRDINQLTRREREILQLISDGMTNK
AIARKLDISESTVKVHVKYLLKKMNLKSRLEAAVWALQNGLH