Protein Info for IAI47_04205 in Pantoea sp. MT58

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01128: IspD
  • amino acids 10 to 230 (221 residues), 271 bits, E=8.8e-85
• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 11 to 228 (218 residues), 243.2 bits, E=1.1e-76
• PF12804: NTP_transf_3
  • amino acids 12 to 149 (138 residues), 52.2 bits, E=8.4e-18

Best Hits

Swiss-Prot: 73% identical to ISPD_SERP5: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 99% identity to pva:Pvag_2444)

MetaCyc: 70% identical to 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase. [EC: 2.7.7.60]

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• isoprene biosynthesis I (9/10 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Protein Sequence (238 amino acids)

>IAI47_04205 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Pantoea sp. MT58)
MNTLASLADVIAVVPAAGIGSRMQATCPKQYLTIGQHTLLEHSIARLFSHPAIRQVIVAL
SPDDQHFASLPLARDPRVLRVTGGETRAESVLAGLQAAQGSAWVLVHDAARPCLHPDDLQ
KLLNVREQSHVGGILAAPVRDTMKRGEPGKAAVAHTVERDDLWHALTPQFFPHALLTACL
TRALTEGATITDEASALEYCGYHPLLVSGRSDNIKVTRPEDLALAAFYLSQIQLKESA