Protein Info for IAI47_04195 in Pantoea sp. MT58

Annotation: DUF3561 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details PF12084: DUF3561" amino acids 1 to 105 (105 residues), 137.1 bits, see alignment E=1.2e-44

Best Hits

Swiss-Prot: 49% identical to YGBE_ECOLI: Inner membrane protein YgbE (ygbE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to pva:Pvag_2446)

Predicted SEED Role

"Putative cytochrome oxidase subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>IAI47_04195 DUF3561 family protein (Pantoea sp. MT58)
MQNITPMLARKDDSSQDEPRSLLPGGVIGLLAYWCALALPFLLFGSNTLFFFLYTWPFFL
ALLPVAVVTGIALNTLLSGHWIWAALATVIMVVTLFWLMFSFLSGW