Protein Info for IAI47_04170 in Pantoea sp. MT58

Annotation: aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF04389: Peptidase_M28" amino acids 98 to 288 (191 residues), 71.6 bits, see alignment E=3.8e-24

Best Hits

Swiss-Prot: 51% identical to IAP_ECOLI: Alkaline phosphatase isozyme conversion protein (iap) from Escherichia coli (strain K12)

KEGG orthology group: K09612, alkaline phosphatase isozyme conversion protein [EC: 3.4.11.-] (inferred from 95% identity to pva:Pvag_2451)

MetaCyc: 51% identical to alkaline phosphatase isozyme conversion protein (Escherichia coli K-12 substr. MG1655)
3.4.11.-

Predicted SEED Role

"Alkaline phosphatase isozyme conversion protein precursor (EC 3.4.11.-)" (EC 3.4.11.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.-

Use Curated BLAST to search for 3.4.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>IAI47_04170 aminopeptidase (Pantoea sp. MT58)
MFCSLRLRVATVLFSALISPLVLATPTGQFAEQQVRHIATYFPGRMSGSPAELMATDYLQ
QQFTALGYKTDTRQFNTGYKWQEDDGTQRWHKLTATSVIAARAGSVPQEILIVAHLDTWT
PQNSNQVHHNLGGLRLQGVDDNASGLGVMLELAQQLSRKPLHYGIRFVALSAGEADLHGL
DDYVERMSTREKKNTLLVINLNSLITGDHLYFNSGMNTPRAVRKQTSDRALLLARQQGIP
AASHQLNRKDFNGLNAFDKAGFPLLNVTASNWSLGNKDGALQRHHSPHFPDGVTRHQTDL
DNLNYLDRWLPGQIALRTRDSVRVLLPLISELTNPKV