Protein Info for IAI47_04135 in Pantoea sp. MT58
Annotation: phosphopyruvate hydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 97% identical to ENO_ERWT9: Enolase (eno) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 99% identity to pam:PANA_3075)MetaCyc: 94% identical to enolase (Escherichia coli K-12 substr. MG1655)
Phosphopyruvate hydratase. [EC: 4.2.1.11]
Predicted SEED Role
"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- superpathway of glucose and xylose degradation (16/17 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
- glycolysis I (from glucose 6-phosphate) (13/13 steps found)
- superpathway of L-tryptophan biosynthesis (13/13 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (17/19 steps found)
- superpathway of anaerobic sucrose degradation (17/19 steps found)
- Bifidobacterium shunt (14/15 steps found)
- glycolysis II (from fructose 6-phosphate) (11/11 steps found)
- glycolysis III (from glucose) (11/11 steps found)
- heterolactic fermentation (16/18 steps found)
- superpathway of hexitol degradation (bacteria) (16/18 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- gluconeogenesis I (12/13 steps found)
- homolactic fermentation (11/12 steps found)
- superpathway of N-acetylneuraminate degradation (18/22 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- chorismate biosynthesis I (7/7 steps found)
- Rubisco shunt (9/10 steps found)
- superpathway of chorismate metabolism (44/59 steps found)
- Entner-Doudoroff pathway I (8/9 steps found)
- chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
- glycolysis IV (8/10 steps found)
- Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
- gluconeogenesis III (9/12 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- glycolysis VI (from fructose) (8/11 steps found)
- ethene biosynthesis V (engineered) (18/25 steps found)
- gallate biosynthesis (2/3 steps found)
- quinate degradation I (2/3 steps found)
- glycolysis V (Pyrococcus) (7/10 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
- glycerol degradation to butanol (11/16 steps found)
- chorismate biosynthesis II (archaea) (8/12 steps found)
- quinate degradation II (1/3 steps found)
- formaldehyde assimilation I (serine pathway) (8/13 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (7/35 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (6/42 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.1.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (431 amino acids)
>IAI47_04135 phosphopyruvate hydratase (Pantoea sp. MT58) MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTGSREALELRDGDKSRFL GKGVTKAVAAVNGPIAEAVKGKDAKDQANIDKIMIDLDGTENKSNFGANAILAVSLAAAK AAAASKGQPLYEHIAELNGTPGKYSMPLPMMNIINGGEHADNNVDIQEFMIQPVGAANLK EAIRMGSEVFHNLAKVLKSKGMSTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD ITLAMDCAASEFYKDGKYVLAGEGGKAFTSEEFTHFLEDLTKQYPIVSIEDGLDESDWDG FAYQTKVLGDKIQLVGDDLFVTNTKILKEGIDKGIANSILIKFNQIGSLTETLAAIKMAK DAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGSKA PFNGLKEVKGQ