Protein Info for IAI47_04115 in Pantoea sp. MT58

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 12 to 66 (55 residues), 47.2 bits, 3.4e-16
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 24 to 430 (407 residues), 460.5 bits, E=2.8e-142
• PF05958: tRNA_U5-meth_tr
  • amino acids 100 to 437 (338 residues), 99 bits, E=6.2e-32
• PF01135: PCMT
  • amino acids 278 to 344 (67 residues), 27.3 bits, E=6.2e-10
• PF13847: Methyltransf_31
  • amino acids 292 to 369 (78 residues), 34.5 bits, E=3.4e-12

Best Hits

Swiss-Prot: 70% identical to RLMD_ERWT9: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 95% identity to pva:Pvag_2462)

MetaCyc: 62% identical to 23S rRNA m5U1939 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11601 [EC: 2.1.1.190]

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.190

Protein Sequence (438 amino acids)

>IAI47_04115 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Pantoea sp. MT58)
MAQFYVAKQRVTTQQRLTVTIEELDPFGQGVARHKGKTLFVAGALPGEQAEIVLTEDKRQ
FARAKVTRLISRSPARVTPRCPHYDRCGGCQQQHADVALQQQSKAQALSRMLSQAASQSV
AVDEVIAGQPWGYRRRARLGLQWQNKAQRLQMGFRQEASNDLVDIQHCPVLVPELEALLV
PLHQCLSDLRAVRRLGHVELVLADNGPLMILRHLDALHTDDREKLEQFSHKHQLMLFLDA
GDENLTALSESMPFYHSHQLKLTFNPQDFIQVNDGVNQQMVAKAIAWLDLQPEDRVLDLF
CGMGNFTLPVGIFVQNVVGVEGIAALVRQAAYNADLNNLKNVSFFQHNLEEEVSRQPWAT
QGFNKVLLDPARAGAAGVMAHVVKLAPERVVYVSCNPTTLARDSQILLSAGYQLERVAML
DMFPHTRHLESMVLFRKT