Protein Info for IAI47_04010 in Pantoea sp. MT58

Annotation: cysteine desulfurase sulfur acceptor subunit CsdE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03391: cysteine desulfurase, sulfur acceptor subunit CsdE
  • amino acids 7 to 144 (138 residues), 230.2 bits, E=3.6e-73
• PF02657: SufE
  • amino acids 22 to 141 (120 residues), 129 bits, E=4.1e-42

Best Hits

Swiss-Prot: 62% identical to CSDE_ECOLI: Sulfur acceptor protein CsdE (csdE) from Escherichia coli (strain K12)

KEGG orthology group: K02426, cysteine desulfuration protein SufE (inferred from 96% identity to pva:Pvag_2483)

MetaCyc: 62% identical to sulfur acceptor protein CsdE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE, sulfur acceptor protein CsdE"

Protein Sequence (151 amino acids)

>IAI47_04010 cysteine desulfurase sulfur acceptor subunit CsdE (Pantoea sp. MT58)
MCSSLLAPHPFGEQITVASLKESFGRFHQWEDRYRQLIQLSRQLPGLPEELKTAEIELSG
CENRVWLGSQLCEDGTLHFYGDSEGRIVRGLLAVLLTAVEGQTPQQLLASDPLTLFDELG
LRAQLSASRSSGLQALATAVEHAARQALTAS