Protein Info for IAI47_03825 in Pantoea sp. MT58

Annotation: bifunctional protein-disulfide isomerase/oxidoreductase DsbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF10411: DsbC_N" amino acids 27 to 78 (52 residues), 51.6 bits, see alignment E=7.6e-18 PF13098: Thioredoxin_2" amino acids 105 to 230 (126 residues), 83.3 bits, see alignment E=2.1e-27

Best Hits

Swiss-Prot: 63% identical to DSBC_DICD3: Thiol:disulfide interchange protein DsbC (dsbC) from Dickeya dadantii (strain 3937)

KEGG orthology group: K03981, thiol:disulfide interchange protein DsbC [EC: 5.3.4.1] (inferred from 100% identity to pva:Pvag_2517)

MetaCyc: 63% identical to protein disulfide isomerase DsbC (Escherichia coli K-12 substr. MG1655)
Protein disulfide-isomerase. [EC: 5.3.4.1]

Predicted SEED Role

"Thiol:disulfide interchange protein DsbC" in subsystem Periplasmic disulfide interchange

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>IAI47_03825 bifunctional protein-disulfide isomerase/oxidoreductase DsbC (Pantoea sp. MT58)
MNKHFAMLALLASAFSGLAQADDSAIQQSLKKLGLNQTEISPSPLPGFKTVLSESGVLYV
TDDGKHMIQGPLYDVSGKQPVNVTNQLLDKKVEALVPEMIVYKAPKEQHVITVFTDITCG
YCHKLHEQMADYNALGITVRYLAFPREGLNGQIEPAMKAIWCSADRNKAFDEAMKGNAPK
MAAPDSCKIDISQHYKLGVLFGIQGTPAMLTDTGMMIPGYQSPQELKQVLDNQKRGG