Protein Info for IAI47_03720 in Pantoea sp. MT58

Annotation: ribose-5-phosphate isomerase RpiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 6 to 215 (210 residues), 231.2 bits, E=4.6e-73
• PF06026: Rib_5-P_isom_A
  • amino acids 49 to 213 (165 residues), 205.3 bits, E=2.8e-65

Best Hits

Swiss-Prot: 84% identical to RPIA_ERWT9: Ribose-5-phosphate isomerase A (rpiA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 99% identity to pva:Pvag_2539)

MetaCyc: 83% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• Bifidobacterium shunt (14/15 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pentose phosphate pathway (8/8 steps found)
• Rubisco shunt (9/10 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (8/9 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Protein Sequence (219 amino acids)

>IAI47_03720 ribose-5-phosphate isomerase RpiA (Pantoea sp. MT58)
MTQDELKKAVGWAALDYVQPGTIVGVGTGSTAAHFIDALATVRHQIDGAVSSSDASTQKL
KSLGIQVFDLNEIDVLSVYVDGADEINPQMQMIKGGGAALTREKIVAAVAETFICIADAS
KEVDVLGRFPLPVEVIPMARSYVARQLVKMGGLPEYRQNVVTDNGNIILDVHNLRILDPI
ELEKTINALPGVVTVGLFAARGADIALIGGPDGVKTIKK