Protein Info for IAI47_03705 in Pantoea sp. MT58

Annotation: arginine exporter ArgO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 61 (25 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details PF01810: LysE" amino acids 14 to 202 (189 residues), 171.2 bits, see alignment E=9.6e-55 TIGR00948: L-lysine exporter" amino acids 15 to 192 (178 residues), 218.5 bits, see alignment E=2.7e-69

Best Hits

Swiss-Prot: 76% identical to ARGO_ECOLI: Arginine exporter protein ArgO (argO) from Escherichia coli (strain K12)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 97% identity to pva:Pvag_2542)

MetaCyc: 76% identical to L-arginine exporter (Escherichia coli K-12 substr. MG1655)
RXN66-448; TRANS-RXN-325

Predicted SEED Role

"Arginine exporter protein ArgO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>IAI47_03705 arginine exporter ArgO (Pantoea sp. MT58)
MISLYFQGLALGAALILPLGPQNAFVMNQGVKRQYHLMTAALCSLSDILLICGGIFGGSA
LLSQSPLLLMVITWAGVAFLLWYGWGALRSAFRGNADLADGEPLKQSRGRIIATLLAVTW
LNPHVYLDTFVVLGSLGGQLPSTTARQWFALGTVSASILWFFGLALLAAWLSPRLRTAKA
QRVINLLVGAVMWFIALQLARQGIAGF