Protein Info for IAI47_03700 in Pantoea sp. MT58

Annotation: small-conductance mechanosensitive channel MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 15 to 64 (50 residues), 51.8 bits, see alignment 1.2e-17 PF21088: MS_channel_1st" amino acids 72 to 112 (41 residues), 38.2 bits, see alignment 2.2e-13 PF00924: MS_channel_2nd" amino acids 113 to 180 (68 residues), 68.3 bits, see alignment E=1e-22 PF21082: MS_channel_3rd" amino acids 187 to 268 (82 residues), 54.2 bits, see alignment E=3.2e-18

Best Hits

Swiss-Prot: 70% identical to MSCS_ECO57: Small-conductance mechanosensitive channel (mscS) from Escherichia coli O157:H7

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 82% identity to pao:Pat9b_3200)

MetaCyc: 70% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>IAI47_03700 small-conductance mechanosensitive channel MscS (Pantoea sp. MT58)
MQDTGMFDELNNAGNWIVRNQELLISYAVNIVAAIAIIFVGMIVARIISNTVNRLLCARH
IDTTVADFLSALVRYGIIAFTLIAALGRIGVQTTSVIAILGAAGLAVGLALKDSLSNLAA
GVLLVIFRHFRTGEFVDLGGIMGTVMNVQIFSTTLKSADGKRVVVPNGKILAGNIVNFSR
EPVRRNEFIIGVSYDADVDQVLTLLREVVEADERVLKDMGIQIGLNELAASSMNFVVRCW
SNSGDLQNVYWDLMKNFKRTLDGKGIGIPYPQMDVHLHRVRPSDTPAPETQPQ