Protein Info for IAI47_03665 in Pantoea sp. MT58

Annotation: agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01230: agmatinase
  • amino acids 24 to 299 (276 residues), 334.8 bits, E=2.3e-104
• PF00491: Arginase
  • amino acids 35 to 298 (264 residues), 291.3 bits, E=4.1e-91

Best Hits

Swiss-Prot: 80% identical to SPEB_CROS8: Agmatinase (speB) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 98% identity to pam:PANA_3208)

MetaCyc: 80% identical to agmatinase (Escherichia coli K-12 substr. MG1655)
Agmatinase. [EC: 3.5.3.11]

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• superpathway of polyamine biosynthesis I (7/8 steps found)
• superpathway of L-arginine and L-ornithine degradation (10/13 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• superpathway of putrescine biosynthesis (3/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (8/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.11

Protein Sequence (306 amino acids)

>IAI47_03665 agmatinase (Pantoea sp. MT58)
MYNTLGNQYDNSLVSNAFGFMRFPLNFQPYDSDAEWVITGVPFDAATSGRPGSRLGPGAI
RQISTNLAWEGCRWPWDFDLRQRLNVVDCGDLVYAFGDSQDLSDKLQAHAEKLLASGKRM
MTFGGDHYVTLPLLRAHAKHFGKMALVHFDAHTDTYSNGPTFDHGTMFFTAPKEGLIDPQ
HSVQIGIRTEFDRSLGFNVLDAAQVNDRSVDDILAEVKRTVGDLPIYLTFDIDCLDPAHA
PGTGTPVIGGLTTDKATKLIRGLQGMNIVGMDLVEVAPGYDHADLTALAAATLALDMLHV
QAANKG