Protein Info for IAI47_03645 in Pantoea sp. MT58

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 43 (18 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details amino acids 386 to 402 (17 residues), see Phobius details PF04932: Wzy_C" amino acids 193 to 343 (151 residues), 48.5 bits, see alignment E=4.2e-17

Best Hits

KEGG orthology group: K02847, O-antigen ligase [EC: 6.-.-.-] (inferred from 92% identity to pva:Pvag_2556)

Predicted SEED Role

"O-antigen ligase" in subsystem LOS core oligosaccharide biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.-.-.-

Use Curated BLAST to search for 6.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>IAI47_03645 O-antigen ligase family protein (Pantoea sp. MT58)
MVNFSVIALCLALSLNMFVTGLPQKIFYLVSYLSVASVLYGLVRRREDFKENGFYIALFA
VLIIFALIRLFWAIHAKGIETAPSKDAITNIGNYLLGAKRLLLGAFVLLSLAIYGHRVSA
TTLRIGKVLILVGLLITLGFGIHEHLYTENIRIKLTTEAASMSSYMILFIYCAWLWLSRF
ETHSYWKVADVVALAVTFALLYLCGTRVTLIALIAAGLLFLVQTYRLSLLTNWRISALLV
GVLAVLILMTSNRWVEGVQDIENYGSNSSTSLGARVAIWGGAMNFIEHHGGFATPDARTT
EARQFITAHYPHNTEGYTNVKYNMHNEFLEVTTLQGWLGALSLALLYLTVLAGVLKKCDL
RGVALPMLGLFICGLTDSVLPYNQTATIFIMALALCCIRRPLPVTAA