Protein Info for IAI47_03535 in Pantoea sp. MT58

Annotation: CinA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 7 to 159 (153 residues), 165.4 bits, E=3.9e-53
• TIGR00199: amidohydrolase, PncC family
  • amino acids 14 to 160 (147 residues), 151.6 bits, E=8.4e-49

Best Hits

Swiss-Prot: 41% identical to PNCC_ENTAG: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Enterobacter agglomerans

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_2579)

MetaCyc: 41% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA paralog, YdeJ"

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Protein Sequence (165 amino acids)

>IAI47_03535 CinA family protein (Pantoea sp. MT58)
MAKSLDQTAEQLGNILLSSGLHLATAESCTAGLISMTLAAVENSGDFYTSGFVTYSENAK
IRLLGVKPETLKQHTAVSEKTAREMVQGACARSGEPVGLSITGYAGPDGGEDGTPAGTIW
FGWVLPDGRDEAECHQFSGDPKSVMEQGTQFALEGLIKRLQRADR