Protein Info for IAI47_03435 in Pantoea sp. MT58

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR00229: PAS domain S-box protein" amino acids 49 to 155 (107 residues), 39.3 bits, see alignment E=6.4e-14 PF08447: PAS_3" amino acids 55 to 142 (88 residues), 75.2 bits, see alignment E=4e-25 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 156 to 312 (157 residues), 108 bits, see alignment E=4.1e-35 PF00990: GGDEF" amino acids 159 to 308 (150 residues), 114 bits, see alignment E=5.9e-37

Best Hits

KEGG orthology group: None (inferred from 92% identity to pva:Pvag_2597)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>IAI47_03435 sensor domain-containing diguanylate cyclase (Pantoea sp. MT58)
MSEEALRLQIQNLKKHNARLKRIAHDARTKLNAALDGTGLFLWQLDIPSGKLVIFNRRWG
AMLGFQPKETDANFESWKESLHPEDADEVLQAFNDHIAGKAPYYEALHRMIAKNGSITWV
LDRGRVSEWNAHGEPVKVIGTHIDMTKEKQYEEQLALLALHDPLTMLNNRHALQNYFCEL
KAQGPLCVVFIDLDNFKHVNDTLGHRSGDEVLIQLSHRFTELAPTEVMIGRLGGDEFVLL
LPFAIDHPQVRQLAHACLDAVLAPFDMANGHALIGASVGVSQVQGRDDFDTALARADEAM
YRIKKNGKRGVAFDHAFPDPL