Protein Info for IAI47_03400 in Pantoea sp. MT58

Annotation: deoxyribose-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01791: DeoC
  • amino acids 11 to 244 (234 residues), 150.5 bits, E=3e-48
• TIGR00126: deoxyribose-phosphate aldolase
  • amino acids 11 to 232 (222 residues), 271.8 bits, E=1.7e-85

Best Hits

Swiss-Prot: 83% identical to DEOC_SALDC: Deoxyribose-phosphate aldolase (deoC) from Salmonella dublin (strain CT_02021853)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 98% identity to pva:Pvag_2604)

MetaCyc: 83% identical to deoxyribose-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
Deoxyribose-phosphate aldolase. [EC: 4.1.2.4]

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

• superpathway of purine deoxyribonucleosides degradation (7/7 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (6/6 steps found)
• 2-deoxy-α-D-ribose 1-phosphate degradation (3/3 steps found)
• 2-deoxy-D-ribose degradation I (3/3 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.4

Protein Sequence (259 amino acids)

>IAI47_03400 deoxyribose-phosphate aldolase (Pantoea sp. MT58)
MTDIKHLALRALKLMDLTTLNDDDTDAKVIALCHQAKSPAGNTAAICIYPRFIPIARKTL
REQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALIAGNSQVGFD
LVKACKTACAEADVLLKVIIETGELKQESLIRQASEIAIDAGADFIKTSTGKVPVNATPE
VAQIMMNVIRDKGVSKQVGFKPAGGVRTAEDAAIYLQMAEDTLGADWADARHFRFGASSL
LASLLNTLGHDSDTSKAGY