Protein Info for IAI47_03355 in Pantoea sp. MT58

Annotation: urea carboxylase-associated family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09347: DUF1989
  • amino acids 21 to 181 (161 residues), 119.9 bits, E=4.8e-39

Best Hits

KEGG orthology group: None (inferred from 80% identity to pao:Pat9b_3167)

Predicted SEED Role

"Aminomethyltransferase (EC 2.1.2.10)" (EC 2.1.2.10)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Nitrogen metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.10

Use Curated BLAST to search for 2.1.2.10

Protein Sequence (215 amino acids)

>IAI47_03355 urea carboxylase-associated family protein (Pantoea sp. MT58)
MLLMREGFTEDAPRSVAAPLTVAAGSVGSIQVLRGQLLRISALAPGAVASLFGFSLVDPA
VWLSVHHTRVFSNSYLLGSGMRLVNNRRRPMMVLGKDSVKRHDLLLPASTRDFLASRGYQ
DEGCVEAVSRELSRLGIRAPKLPDPINLFMHVRLTQAGEILPEPNLTRAGDAITCRVTMD
MQFVVSACNTGIEGNDQPAPLRLAVAENLFDFNED