Protein Info for IAI47_03335 in Pantoea sp. MT58

Annotation: M20 peptidase aminoacylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 TIGR01891: amidohydrolase" amino acids 9 to 354 (346 residues), 262.5 bits, see alignment E=3.3e-82 PF01546: Peptidase_M20" amino acids 63 to 363 (301 residues), 93 bits, see alignment E=2.6e-30 PF07687: M20_dimer" amino acids 169 to 257 (89 residues), 34.1 bits, see alignment E=2.3e-12

Best Hits

Swiss-Prot: 38% identical to AMHX_BACSU: Amidohydrolase AmhX (amhX) from Bacillus subtilis (strain 168)

KEGG orthology group: K14665, amidohydrolase [EC: 3.5.1.-] (inferred from 98% identity to pva:Pvag_2610)

Predicted SEED Role

"ILL6; metallopeptidase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>IAI47_03335 M20 peptidase aminoacylase family protein (Pantoea sp. MT58)
MSEVLEHYHYLHEIPELGFQEVKTSAYIADQLEKAGLKVTRNINNTTGIVAEIDSGVPGP
VLALRADMDALGHIIDGVPCARHTCGHDGHSSVVLTAATALLQEGTVKRGRLKILFQPAE
ELGAGALAMIEGGALDDVEMILGFHLRPLEECVVGQAVPAVLYSACSTLEATIKGQPAHA
ARPHLGVNALDAAVQAVQAVNAIHLSPGLTWSVKATRFLCDAGVTNSVPDEARVVWDLRS
QENGPMTLLKEQVTRAITHSVAALGATAEVRVLKEMPAAEIDDEATAVIRAAIVEVLGEE
GALSTRTTPGSEDFFYYPVKRPGVKAGFWGLGTNLTPGLHHPDMRFDLSSLEIGVQIFKA
CVRKVLG