Protein Info for IAI47_03335 in Pantoea sp. MT58

Annotation: M20 peptidase aminoacylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01891: amidohydrolase
  • amino acids 9 to 354 (346 residues), 262.5 bits, E=3.3e-82
• PF01546: Peptidase_M20
  • amino acids 63 to 363 (301 residues), 93 bits, E=2.6e-30
• PF07687: M20_dimer
  • amino acids 169 to 257 (89 residues), 34.1 bits, E=2.3e-12

Best Hits

Swiss-Prot: 38% identical to AMHX_BACSU: Amidohydrolase AmhX (amhX) from Bacillus subtilis (strain 168)

KEGG orthology group: K14665, amidohydrolase [EC: 3.5.1.-] (inferred from 98% identity to pva:Pvag_2610)

Predicted SEED Role

"ILL6; metallopeptidase"

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Protein Sequence (367 amino acids)

>IAI47_03335 M20 peptidase aminoacylase family protein (Pantoea sp. MT58)
MSEVLEHYHYLHEIPELGFQEVKTSAYIADQLEKAGLKVTRNINNTTGIVAEIDSGVPGP
VLALRADMDALGHIIDGVPCARHTCGHDGHSSVVLTAATALLQEGTVKRGRLKILFQPAE
ELGAGALAMIEGGALDDVEMILGFHLRPLEECVVGQAVPAVLYSACSTLEATIKGQPAHA
ARPHLGVNALDAAVQAVQAVNAIHLSPGLTWSVKATRFLCDAGVTNSVPDEARVVWDLRS
QENGPMTLLKEQVTRAITHSVAALGATAEVRVLKEMPAAEIDDEATAVIRAAIVEVLGEE
GALSTRTTPGSEDFFYYPVKRPGVKAGFWGLGTNLTPGLHHPDMRFDLSSLEIGVQIFKA
CVRKVLG