Protein Info for IAI47_03280 in Pantoea sp. MT58

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03707: MHYT
  • amino acids 52 to 110 (59 residues), 67.3 bits, 1.4e-22
  • amino acids 115 to 166 (52 residues), 53 bits, 4.2e-18
  • amino acids 183 to 243 (61 residues), 29.4 bits, 1e-10
• TIGR00254: diguanylate cyclase (GGDEF) domain
  • amino acids 258 to 420 (163 residues), 131.7 bits, E=1e-42
• PF00990: GGDEF
  • amino acids 262 to 417 (156 residues), 150.9 bits, E=4.1e-48
• PF00563: EAL
  • amino acids 438 to 673 (236 residues), 250.8 bits, E=1.8e-78

Best Hits

Swiss-Prot: 62% identical to Y1727_PSEAE: Uncharacterized signaling protein PA1727 (PA1727) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 94% identity to pva:Pvag_2621)

Predicted SEED Role

"Transcriptional regulator, GntR family domain / Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (9/9 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• superpathway of L-aspartate and L-asparagine biosynthesis (4/4 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• L-glutamate degradation II (2/2 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
• L-aspartate biosynthesis (1/1 steps found)
• L-aspartate degradation I (1/1 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• L-asparagine degradation III (mammalian) (2/3 steps found)
• L-phenylalanine degradation II (anaerobic) (2/3 steps found)
• indole-3-acetate biosynthesis VI (bacteria) (2/3 steps found)
• L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
• L-tyrosine degradation II (1/2 steps found)
• atromentin biosynthesis (1/2 steps found)
• trans-4-hydroxy-L-proline degradation I (3/5 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tryptophan degradation VIII (to tryptophol) (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• (R)-cysteate degradation (1/3 steps found)
• L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
• sulfolactate degradation III (1/3 steps found)
• L-tyrosine degradation I (2/5 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• superpathway of sulfolactate degradation (2/6 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
• 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
• L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
• L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
• L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (7/14 steps found)
• coenzyme M biosynthesis II (1/6 steps found)
• indole-3-acetate biosynthesis II (4/12 steps found)
• rosmarinic acid biosynthesis I (1/10 steps found)
• (S)-reticuline biosynthesis I (1/11 steps found)
• superpathway of rosmarinic acid biosynthesis (1/14 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (3/27 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Cysteine metabolism
• Glutamate metabolism
• Novobiocin biosynthesis
• Phenylalanine metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Protein Sequence (714 amino acids)

>IAI47_03280 EAL domain-containing protein (Pantoea sp. MT58)
MLATSYDSFIVIVSVLVAMLASFTALDMAGRVVHSTGKVALVWLFGGGFSMGIGIWAMHF
IGMLSMNMEMVMSYNAGLTAFSAAIAVCASIFALWLVCSGDLPLPRLAGGALILGSGVVA
MHYTGMAALMFSPGIVWRWGWIGLSVVIALAASGAALWLAFNLREGQTGRVTLLRIGASV
VMGCAIAGMHYTGMMAAEFPAHSHSMGQGVNSNWLAILVTVVTISILGITLLVSMLDARM
QARTSILASSLAEANRELAQLALHDNLTRLPNRILLEDRLEQAINKANREQTLFALMFMD
LDGFKAVNDAFGHHIGDSLLVGVTERMSQQMAGYYTLARLGGDEFVLLVEIDDPNDAAAI
ADKLVKAVDRPFDISRYELVVSLSLGIAVYPGDGEDERELMFNADAAMYHTKNNGRNGYT
FFQPSMNIQAQSQLQLNNDLWQALDNNELRLFYQPKYCAPRGPLLGFEALLRWEHPKRGL
LSPDKFLPMAEKTGMIVNIGNWVINEACRQLRQWHLQGHTDWSVAVNLSALQFEQSNLVE
TVVDALAKHQIPAELLTLEVTETTAMRDPDESVRILTQLTQLGVKASIDDFGTGYSSLLY
LKRLPASELKIDRAFVNELQHQPEDATIVSAIVALAQSLQLKVVAEGVETAEQQAFLTGL
GCNTLQGFLLGRPVPAEQVPELANFVVAEDEEVVTDIRQMSEAEPLLTPQVAAI