Protein Info for IAI47_03275 in Pantoea sp. MT58

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details PF03707: MHYT" amino acids 52 to 108 (57 residues), 57.3 bits, see alignment 1.9e-19 amino acids 118 to 172 (55 residues), 52.2 bits, see alignment 7.7e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 257 to 417 (161 residues), 133.7 bits, see alignment E=2.5e-43 PF00990: GGDEF" amino acids 260 to 415 (156 residues), 147.5 bits, see alignment E=4.5e-47 PF00563: EAL" amino acids 436 to 671 (236 residues), 227.6 bits, see alignment E=2.3e-71

Best Hits

Swiss-Prot: 52% identical to Y1727_PSEAE: Uncharacterized signaling protein PA1727 (PA1727) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 90% identity to pva:Pvag_2622)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (694 amino acids)

>IAI47_03275 EAL domain-containing protein (Pantoea sp. MT58)
MLLVTWDSVLICVSLIVAFIASFTALDTAGRVAVSRGWSARFWLLAGGTAMGIGVWAMHF
IGMLAMMMPMTMRYDTRLTILSLLVAIMPSMFAFGQTVGGLHLTRYRLLRGTLILSSGIV
VMHYLGMYALLIEPRPEWNVLRVALSVIIAFVASGVALWLAFHLRQGDHHLLLMRGLASL
VMGMAIAGMHYVGMSAARFSESSMMQSGGVSNSGLAVWVTLITLIILGITLLSSMLDAQL
RAARLATRLRHANQELRQLAMHDNLTALPNRAMLEQQLDLAIKQAMLNENRFAVIYMDLD
GFKAVNDTWGHHVGDRLLVAVSERLRSQLSNTMLLVRLGGDEFVLMAEACDVTPARQLAQ
KLVKVISTPFELDRYVLHVSLSAGIAIFPLHGRNRQELLFNADSAMYHTKHSGRNGWCLF
EPAMSDATQHQLALANDLWEAIDRQQMRLFYQPKFRSGGTRLMGFEALLRWQHPQRGLLT
PELFLPRAEKTGQIVALGNWVIDEACRQLKIWHNQGNSDWTVSVNLSALQFHQRDLLHTL
MQTLARYQLSGSALMLEITEAIAMRDPLFSQQRIRELQQAGVSVAIDNFGIGYANLLHLK
DLDASELKIDRSFINCLRPGSEDATVVSAMLTLAQSLNLRMVAEGVETEEQQHLLTSLGF
DALQGYLLGKPTPADRIEAFRFPGLRPPLASASV