Protein Info for IAI47_03240 in Pantoea sp. MT58

Annotation: TonB system transport protein ExbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02472: ExbD
  • amino acids 14 to 132 (119 residues), 107 bits, E=4e-35
• TIGR02803: TonB system transport protein ExbD
  • amino acids 15 to 136 (122 residues), 216.2 bits, E=5.2e-69

Best Hits

Swiss-Prot: 73% identical to EXBD_ECOLI: Biopolymer transport protein ExbD (exbD) from Escherichia coli (strain K12)

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 99% identity to pva:Pvag_2629)

MetaCyc: 73% identical to Ton complex subunit ExbD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Protein Sequence (140 amino acids)

>IAI47_03240 TonB system transport protein ExbD (Pantoea sp. MT58)
MAMRLNDDLQTDGEMHEINVTPFIDVMLVLLIIFMVAAPLATVDVRVNLPASTSAPQPRP
EKPVYLSIKADKQLYVGNDQVTPDSLVNVLTSQTQGNKETTIFFQADKSVDYETLMSVMD
KLRTAGYLKIGLMGMETVKK