Protein Info for IAI47_03230 in Pantoea sp. MT58

Annotation: TRAP transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03480: DctP" amino acids 29 to 307 (279 residues), 261.6 bits, see alignment E=4.7e-82 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 31 to 284 (254 residues), 229.7 bits, see alignment E=2e-72

Best Hits

Swiss-Prot: 33% identical to DCTP_CHRSD: Solute-binding protein Csal_2479 (dctP) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

KEGG orthology group: None (inferred from 93% identity to pva:Pvag_2631)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>IAI47_03230 TRAP transporter substrate-binding protein (Pantoea sp. MT58)
MRLTKTCLASALAAIMISSTATAQVIKVAEVQPAGYPTVVALQHMGDKLKQATDGRLEMK
IYAGGVLGDEDQTLQQVQLGAIDMIRVSLAPVTSIAPETSVLTLPYVFRDIDHMHKVLDG
EIGSEIASKFDKDPNARMVFLGWTDAGERNMITKKPLAKPDDLKGMKIRVQNSAISLATL
KAMGANPVAMGVSEVFSAMQTGVVDGTENNPPTFVAHNYMPVAKYYTLTGHFIQPEMILF
SKRAWDRLKPDDQTLLKKLGKEAQDEERQLWATYTEQSIAKMKSGGVTFQQTDRDYFVKA
TQPVRDQFGGKYQDLMTRIADVK