Protein Info for IAI47_02950 in Pantoea sp. MT58

Annotation: 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05175: MTS
  • amino acids 196 to 367 (172 residues), 188.7 bits, E=1.6e-59
• PF06325: PrmA
  • amino acids 227 to 281 (55 residues), 22.9 bits, 1.4e-08
• PF13649: Methyltransf_25
  • amino acids 229 to 331 (103 residues), 27.9 bits, E=7.8e-10

Best Hits

Swiss-Prot: 75% identical to RLMG_ERWT9: Ribosomal RNA large subunit methyltransferase G (rlmG) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K11391, ribosomal RNA large subunit methyltransferase G [EC: 2.1.1.174] (inferred from 97% identity to pva:Pvag_2718)

MetaCyc: 63% identical to 23S rRNA m2G1835 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11635 [EC: 2.1.1.174]

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.174

Protein Sequence (372 amino acids)

>IAI47_02950 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG (Pantoea sp. MT58)
MSQLELNDRTLILHRFPQMRDESPLQAWDAADEYLLQQALPEGPVLIFNDSFGALTCALN
PRTVWHVSDSWLSQQAARQNLSFNEMDDSNVHFVDSLAELPAAPAAVLIKVPKTLALLEH
QLRAIREVVTPDTVIVAAARAKEIHNSTLQLFEQIIGETKTSLAWKKARLIYSQFSQPEL
REATPTLVWPLDGTPYQIHNYANVFSRSSLDIGARLFVQHLPENIEGEIVDLGCGNGVVG
LVALEQNPQAEVHFLDESYMAVASSKLNVEVNRPDDLSRCQFLVNNVLSGYPSDRLHAVL
CNPPFHQQHAVTDHLAWQMFRDAKRCLQYGGELRIVGNRHLDYHHKLKKLFGNCTLIASN
QKFVVLRAVKMR