Protein Info for IAI47_02940 in Pantoea sp. MT58

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 359 to 383 (25 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details amino acids 468 to 486 (19 residues), see Phobius details PF00654: Voltage_CLC" amino acids 67 to 408 (342 residues), 237.3 bits, see alignment E=2.8e-74

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 97% identity to pva:Pvag_2720)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (562 amino acids)

>IAI47_02940 chloride channel protein (Pantoea sp. MT58)
MKASKHALNWTTLLIAIPVGCAASLVTLAFRGVIELINHLLFARSGEITESLHLWPWIFW
PLLVGAGGVLAGYFLRYAVAIEQQQTVKTDYLEVINARLDAVPTRTSLFRALSSIASIGS
GASIGKEGPMVQLSALCGSAIGRLLPASLNLKNSDVVAMAAAAGLASVYHAPLASAIFVA
EIAFGISALQRLIPLIIASATAVMTMWTLGFRSALYPLADANFAMDLSSLLMTVVIGLSA
GLAGWLLIKCIARSKVLFSGIASLPLRLGAGGFAVGLLALISTDILGNGYEVIVKVMAGD
YLLPGLLLLLVLKTLATSLSVGSNAVGGLFTPSLLIGALLGVIIAMIGAALHLPLGNVLL
YAAIGMAAVLAAVSQAPLMAMLMVLEMTLNSSLLFPLMIATVLASMVVYRLQSASTYPVV
SHHFSRSEAKYDFDNMRIAELIIPGAALQPEESVGQALAVSSLKRERYVYVINAAGAFLG
VVSIHEISRRVLAQEITLDSPVQCVMDQDFPVVFQNQSMREGWEAFAAVTLERLPVLNNP
QERRFLGALTKTSLIQKAQEFL