Protein Info for IAI47_02925 in Pantoea sp. MT58

Annotation: serine/threonine transporter SstT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 291 to 317 (27 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details amino acids 363 to 379 (17 residues), see Phobius details PF00375: SDF" amino acids 17 to 399 (383 residues), 212 bits, see alignment E=7.5e-67

Best Hits

Swiss-Prot: 82% identical to SSTT_ERWT9: Serine/threonine transporter SstT (sstT) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 96% identity to pva:Pvag_2723)

MetaCyc: 74% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium:dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>IAI47_02925 serine/threonine transporter SstT (Pantoea sp. MT58)
MQKTFSARLGTLLAGSLVKQILIGLIAGVALAWISHDAALAVGLLGELFVSALKAVAPLL
VLMLVIASIANHQQGQKSNIRPIIMLYLLSTFFAAVVAVVFSHLVPQTLTLAAGTTEIVP
PSGITEVLHGLLMSMVANPITALMQANYIGILVWAIGLGLAFRHSSDSTRALLNDASHAV
TWLVRCVIRCAPVGIFGLVASILASTGFGALWQYAHLLALLIGCMLLMALVVNPMLVFSK
IRRNPYPLVFTCLRESGVTAFFTRSSAANIPVNMALAKRLDLDEDTYSVSIPLGATISMA
GASITITVLTLAAVHTLGISIDVPTAILLSLVASLCACGASGVAGGSLLLIPVACNMFGI
PNDLAMQVVAVGFIIGVLQDSAETALNSSTDILFTAAVCQAEAEREASRA