Protein Info for IAI47_02850 in Pantoea sp. MT58

Annotation: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF00590: TP_methylase" amino acids 13 to 213 (201 residues), 110.1 bits, see alignment E=7.7e-36 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 14 to 284 (271 residues), 352.1 bits, see alignment E=1.1e-109

Best Hits

Swiss-Prot: 84% identical to RSMI_ECO57: Ribosomal RNA small subunit methyltransferase I (rsmI) from Escherichia coli O157:H7

KEGG orthology group: K07056, (no description) (inferred from 99% identity to pva:Pvag_2737)

MetaCyc: 84% identical to 16S rRNA 2'-O-ribose C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11637 [EC: 2.1.1.198]

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.198

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>IAI47_02850 16S rRNA (cytidine(1402)-2'-O)-methyltransferase (Pantoea sp. MT58)
MKQLDRAEISASTLYIVPTPIGNLGDITQRALTVLSSVDLVAAEDTRHTGLLLQHFAINA
RLFSLHDHNEQHKAELLLTKLQEGQSIALVSDAGTPLINDPGYHLVRRCREAGIRVVPLP
GACAAIAALSAAGLPSDRFCYEGFLPAKTKGRCDALRALVQEPRTLIFYESTHRLVDSLQ
DMVSELGPERYVVLARELTKTWESIYGAPVGELLAWVKEDENRRKGEMVLIVEGHKVDDD
DALPADALRTLALLQKELPLKRAAALTAEIHSVKKNALYKYALEQQEA