Protein Info for IAI47_02835 in Pantoea sp. MT58

Annotation: DnaA initiator-associating protein DiaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 13 to 144 (132 residues), 98 bits, E=4.9e-32
• PF01380: SIS
  • amino acids 102 to 153 (52 residues), 25.5 bits, E=1e-09

Best Hits

Swiss-Prot: 94% identical to DIAA_ECOSE: DnaA initiator-associating protein DiaA (diaA) from Escherichia coli (strain SE11)

KEGG orthology group: K12961, DnaA initiator-associating protein (inferred from 100% identity to pva:Pvag_2740)

MetaCyc: 40% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (5/5 steps found)
• GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-, 5.3.1.28

Use Curated BLAST to search for 5.3.1.- or 5.3.1.28

Protein Sequence (195 amino acids)

>IAI47_02835 DnaA initiator-associating protein DiaA (Pantoea sp. MT58)
MQERIKACFTESIQTQIAAAEALPDAISRAAMTLVQSLLNGNKILSCGNGASSANAQHFA
ASMINRFETERPSLPALALSADNVMLTAIGNDRLHDEIYAKQVRALGHAGDVLLAISTRG
NTRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGPQDVEIRIPSHRSARIQEMHMLTVN
CLCDLIDNTLFPHQE