Protein Info for IAI47_02805 in Pantoea sp. MT58

Annotation: DgaE family pyridoxal phosphate-dependent ammonia lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR01437: uncharacterized pyridoxal phosphate-dependent enzyme" amino acids 4 to 366 (363 residues), 579.4 bits, see alignment E=1.3e-178 PF03841: SelA" amino acids 75 to 267 (193 residues), 49.7 bits, see alignment E=4.5e-17 PF01053: Cys_Met_Meta_PP" amino acids 133 to 225 (93 residues), 27.9 bits, see alignment E=1.3e-10 PF01041: DegT_DnrJ_EryC1" amino acids 141 to 192 (52 residues), 20.4 bits, see alignment 4e-08

Best Hits

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 96% identity to pva:Pvag_2746)

Predicted SEED Role

"D-Glucosaminate-6-phosphate ammonia-lyase (EC 4.3.1.-)" (EC 4.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.1 or 4.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>IAI47_02805 DgaE family pyridoxal phosphate-dependent ammonia lyase (Pantoea sp. MT58)
MTSVYEKYGLKPVINASGRMTILGVSTPSSDVVDTVKYGLDHYFEMKDLVDKTGAYIAGL
LKVENALVVSCASAGIAQCVAAVIVKDNDWLVDNLHAAPLTVPHQIVVPKGHNVNYGAPV
GSMVALGGGQLVEAGYSNECSSAQLAAAITPQTAAILYVKSHHCVQKSHLDVGQAAAVAR
EHGLPLIVDAAAEEDLQCYYQAGADLVIYSGAKAIEGPTSGLVIGRHHYVEWVKRQTNGI
GRAMKVGKEGILGLTQAIENYLSQPKISGAQMVEKMTPFIEQLNSLNGVTARVVWDSAGR
DIARAEIKFDEAAIQQRTGDLVQALKKGDVAIYFRGYKANEGIIEADVRSVSADQLHTIF
TRIQALLNGEKHA