Protein Info for IAI47_02645 in Pantoea sp. MT58

Annotation: Cache 3/Cache 2 fusion domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 318 to 337 (20 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 36 to 314 (279 residues), 229.4 bits, see alignment E=1.6e-71 PF17203: sCache_3_2" amino acids 107 to 220 (114 residues), 36.3 bits, see alignment E=1.5e-12 PF17202: sCache_3_3" amino acids 112 to 218 (107 residues), 104.1 bits, see alignment E=1.3e-33 PF00672: HAMP" amino acids 339 to 388 (50 residues), 34.9 bits, see alignment 4e-12 PF00015: MCPsignal" amino acids 454 to 607 (154 residues), 159.5 bits, see alignment E=1.8e-50

Best Hits

KEGG orthology group: None (inferred from 95% identity to pva:Pvag_2781)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (643 amino acids)

>IAI47_02645 Cache 3/Cache 2 fusion domain-containing protein (Pantoea sp. MT58)
MKRLSLSGLSLGVKLSVLTSLSVALLLLVLTLTQSHNASRQLENLAIDDMHNQVQGISEM
ATMFNATLTEEVAHYTDLFTSFLPKRFSLDESSRVQVGAFSTPVLRAGLKTLNLDQTAVD
DFTERTAAVATIFVRDGDDFVRVSTSLKKEDGSRAIGTQLDRTGAAWKRVHQGEVYRGLA
TLFGHRYITQYQPIKDESGKVVAILFVGVGIDKQYALMREKILARKLGDSGHFFVLNGTP
GKTQGAYLFDQHDEGKRPDWDDATLKPLLTEPKGMQQVEINGEMQILAWEQLPDWNWVIT
GEVNRDSLLAPITHSRNLFLITGLVLVIVFALGFVWYSRRAITRPLQQVIHLAEQYAAGN
LQVHMDTLRRDEVGQLIIAINGIGDGLEKIVGQVRGAAQEISDGTDTIAASSHNISEQIG
RQASSVEQTSASMEQFGATVEHTAESLRQAMSLVAEASNIVSHGSKTVVRSVNTMSAIKV
SSQSIADITHVIESIAFQTNILALNAAVEAARAGEQGRGFAVVAAEVRALAQRSAQAAKE
IDGLIATSISNVAEGHQLSEQTRDAMTNIVTHIEQVQALMGEINVAAQEQAAGIGQVNIA
MNQISQATHQNSELVAQAENSAQNLSDKGHHLTQLVSVFSLKS