Protein Info for IAI47_02635 in Pantoea sp. MT58

Annotation: isovaleryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 PF18158: AidB_N" amino acids 10 to 166 (157 residues), 191.3 bits, see alignment E=2.3e-60 PF02770: Acyl-CoA_dh_M" amino acids 181 to 279 (99 residues), 49.5 bits, see alignment E=8e-17 PF00441: Acyl-CoA_dh_1" amino acids 289 to 441 (153 residues), 91.6 bits, see alignment E=1.2e-29 PF08028: Acyl-CoA_dh_2" amino acids 312 to 425 (114 residues), 27.9 bits, see alignment E=5e-10

Best Hits

Swiss-Prot: 70% identical to AIDB_ECOLI: Putative acyl-CoA dehydrogenase AidB (aidB) from Escherichia coli (strain K12)

KEGG orthology group: K09456, putative acyl-CoA dehydrogenase (inferred from 82% identity to pam:PANA_3528)

MetaCyc: 70% identical to isovaleryl-CoA dehydrogenase and DNA-binding transcriptional repressor (Escherichia coli K-12 substr. MG1655)
RXN0-2301 [EC: 1.3.8.4]

Predicted SEED Role

"Alkylation response protein AidB, acyl-CoA dehydrogenase family"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>IAI47_02635 isovaleryl-CoA dehydrogenase (Pantoea sp. MT58)
MTWTTHTVFNQPHPLSNSNLFLSDTPLGEALSREGAGWDREWLASVGRQLGSAESLELGR
LANAEPPELLRYDARGERMDEVRFHPAWHLLMQGVCASRLHNLSWQPTVREQASVARAAR
FILHAQVEAGTLCPVTMTHAAIPLLQTYLPAAFEGWLDPLLSDRYDTHAQPGDQKRGLLI
GMGMTEKQGGSDLLTSTTHAEPLGARGAGEAYRLTGHKWFFSVPQSDAHLVLAQTPAGLS
CFFLPRLLPDGSRNAIQLERLKDKLGNRSNASCEVEFRDATGWLLGEEGEGVRLILKMGG
MTRFDCALGSHGQMRRAFSVAVSHAHQRQVMGKNLVEQPLMRQVLAQQALQLEGQTALLM
RLARAWSQPAKPHEVTFARLFTPAAKYEICKAGAPFVAESMEVLGGIGYCEASELPRLYR
DMPVNSIWEGSGNVMCLDVLRVFARQAEVTAMLSQEFEAVKGSNRHFDTRWRQLRLRLNH
VPEEQAREVTRTLLLLAMGAQLLKYAEPPLADAWCQQWLDQRGSRPLEAAITDRLLDRAC
GR