Protein Info for IAI47_02475 in Pantoea sp. MT58

Annotation: AaeX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 67 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details PF07869: DUF1656" amino acids 7 to 61 (55 residues), 68.4 bits, see alignment E=2.2e-23

Best Hits

Swiss-Prot: 100% identical to AAEX_PANVC: Protein AaeX (aaeX) from Pantoea vagans (strain C9-1)

KEGG orthology group: None (inferred from 91% identity to pao:Pat9b_3577)

Predicted SEED Role

"probable membrane protein YPO3684"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (67 amino acids)

>IAI47_02475 AaeX family protein (Pantoea sp. MT58)
MSVLPVFVMFGLSFPPVFIELIISLMLFWLVKRVLTPSGIYDLVWHPALFNTALYCCVFY
LVSRLLV