Protein Info for IAI47_02405 in Pantoea sp. MT58

Annotation: acetyl-CoA carboxylase biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF00289: Biotin_carb_N" amino acids 1 to 110 (110 residues), 151.1 bits, see alignment E=4.5e-48 TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit" amino acids 1 to 445 (445 residues), 816.5 bits, see alignment E=2.9e-250 PF02655: ATP-grasp_3" amino acids 114 to 294 (181 residues), 31.6 bits, see alignment E=5.2e-11 PF02786: CPSase_L_D2" amino acids 115 to 323 (209 residues), 284.5 bits, see alignment E=1.5e-88 PF02222: ATP-grasp" amino acids 139 to 292 (154 residues), 32.5 bits, see alignment E=2e-11 PF07478: Dala_Dala_lig_C" amino acids 140 to 291 (152 residues), 34.4 bits, see alignment E=4.9e-12 PF02785: Biotin_carb_C" amino acids 336 to 441 (106 residues), 132.1 bits, see alignment E=2.7e-42

Best Hits

Swiss-Prot: 92% identical to ACCC_ECOLI: Biotin carboxylase (accC) from Escherichia coli (strain K12)

KEGG orthology group: K01961, acetyl-CoA carboxylase, biotin carboxylase subunit [EC: 6.3.4.14 6.4.1.2] (inferred from 98% identity to pva:Pvag_2831)

MetaCyc: 92% identical to biotin carboxylase (Escherichia coli K-12 substr. MG1655)
Biotin carboxylase. [EC: 6.3.4.14]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 6.3.4.14 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>IAI47_02405 acetyl-CoA carboxylase biotin carboxylase subunit (Pantoea sp. MT58)
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAQSVKSY
LNIPALISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIFIGPKADTIRLMGDKVSAI
NAMKKAGVPTVPGSDGSLTDDMDKNRAFAKRIGYPVIIKASGGGGGRGMRVVRSDKDLEQ
SINMTKAEAKAAFSNDMVYMEKYLENPRHIEIQVLADGQGNAIYLGERDCSMQRRHQKVV
EEAPGPGITEEQRRFIGNRCAKACIEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEDVIIRGHAVECRINAEDPVTFLPSPGKITRFHAP
GGFGVRWESHIYSGYTVPPYYDSMIGKLITYGESRDVAIARMKNALAELIIDGIKTNVEL
QMKIMSDENFQHGGTNIHYLEKKLGLHEK