Protein Info for IAI47_02305 in Pantoea sp. MT58

Annotation: topoisomerase DNA-binding C4 zinc finger domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF01396: zf-C4_Topoisom" amino acids 15 to 48 (34 residues), 55 bits, see alignment 2.8e-19 amino acids 63 to 98 (36 residues), 52.7 bits, see alignment 1.4e-18 amino acids 106 to 141 (36 residues), 50.1 bits, see alignment 9.4e-18 amino acids 145 to 168 (24 residues), 8.8 bits, see alignment (E = 7.7e-05)

Best Hits

Swiss-Prot: 74% identical to YRDD_ECOLI: Uncharacterized protein YrdD (yrdD) from Escherichia coli (strain K12)

KEGG orthology group: K07479, putative DNA topoisomerase (inferred from 98% identity to pva:Pvag_2852)

Predicted SEED Role

"Similar to C-terminal Zn-finger domain of DNA topoisomerase I" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA topoisomerases, Type I, ATP-independent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>IAI47_02305 topoisomerase DNA-binding C4 zinc finger domain-containing protein (Pantoea sp. MT58)
MSKAALFTVRKQDPCPACGAELVIRSGKHGPFLGCANYPACDYIRPLKGQADGHVVKVLE
GHACPECGADKVLRQGRFGMFIGCSCYPECGYTETIDKPDETSLACPQCHEGRLVQRRSR
YGKTFHSCDRYPACQFVVNLTPVAGICPYCEYPLLVEKKTAQGIKRFCASKSCGKAIAEE
NS