Protein Info for IAI47_02290 in Pantoea sp. MT58

Annotation: peptide deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00079: peptide deformylase
  • amino acids 4 to 160 (157 residues), 213.3 bits, E=7.4e-68
• PF01327: Pep_deformylase
  • amino acids 4 to 152 (149 residues), 181.8 bits, E=3.4e-58

Best Hits

Swiss-Prot: 89% identical to DEF_ERWT9: Peptide deformylase (def) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 99% identity to pva:Pvag_2855)

MetaCyc: 86% identical to peptide deformylase (Escherichia coli K-12 substr. MG1655)
Peptide deformylase. [EC: 3.5.1.88]

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.88

Protein Sequence (170 amino acids)

>IAI47_02290 peptide deformylase (Pantoea sp. MT58)
MSVLQVLHFPDERLRKVAAPVKEVNADIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIV
IDVSESREERLVLINPELLEKSGETGIEEGCLSIPEQRAFVPRAERVKVRALDRDGNSFE
LEASELLAICIQHEIDHLEGKLFIDYLSPLKRQRIKTKLEKLARQNAQAS