Protein Info for IAI47_02280 in Pantoea sp. MT58

Annotation: 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01029: NusB
  • amino acids 7 to 127 (121 residues), 87.1 bits, E=3.4e-28
• TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • amino acids 8 to 429 (422 residues), 569.3 bits, E=3.4e-175
• PF01189: Methyltr_RsmB-F
  • amino acids 240 to 426 (187 residues), 260.1 bits, E=3.4e-81
• PF01728: FtsJ
  • amino acids 246 to 376 (131 residues), 27.7 bits, E=6e-10
• PF13847: Methyltransf_31
  • amino acids 246 to 378 (133 residues), 36.5 bits, E=1e-12
• PF13649: Methyltransf_25
  • amino acids 250 to 321 (72 residues), 27 bits, E=1.5e-09

Best Hits

Swiss-Prot: 72% identical to RSMB_ERWT9: Ribosomal RNA small subunit methyltransferase B (rsmB) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 96% identity to pva:Pvag_2857)

MetaCyc: 74% identical to 16S rRNA m5C967 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11591 [EC: 2.1.1.176]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.176

Protein Sequence (433 amino acids)

>IAI47_02280 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB (Pantoea sp. MT58)
MTKSINLRSLSAQLIERVVDKGESLNTALPAAQKKLSDKDSALVQEICFGVLRTLPQLEA
LIGKLMARPLTGKQRVLHYLIMVGLYQLEYTRVPAHAALAETVAGAEVLKRTSLKGLLNG
VLRQFQRQREELLASIQDGPQRYLHPGWLLKRLQHAWPEQWQQIVEANNQRPPMWLRVNQ
QHHERDAWLALLTESGRNAQPADDVPDALRLDAPAPVSQLPGFGQGWVTVQDLSAQRCAL
LLEPQNGEQILDLCAAPGGKTTHILEIAPEAEVMAVDVDAQRLKRVEENLQRLGMKADVK
QGDGRTPQQWCGDRQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAKLQSEILNAV
WPHLKPGGTLIYATCSILPEENHQQIDAFLQRQHDAQAVPLRDAPANGLQVFPQAEGGDG
FFYAKLIKKSGTN