Protein Info for IAI47_02025 in Pantoea sp. MT58

Annotation: glutathione-regulated potassium-efflux system ancillary protein KefG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02525: Flavodoxin_2
  • amino acids 6 to 172 (167 residues), 150.5 bits, E=5.1e-48
• PF03358: FMN_red
  • amino acids 52 to 113 (62 residues), 25 bits, E=1.2e-09

Best Hits

Swiss-Prot: 82% identical to KEFG_ERWT9: Glutathione-regulated potassium-efflux system ancillary protein KefG (kefG) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_2908)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ancillary protein KefG" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Protein Sequence (183 amino acids)

>IAI47_02025 glutathione-regulated potassium-efflux system ancillary protein KefG (Pantoea sp. MT58)
MSQPPRVLLLYAHPESQDSIANRILLQPAQALEHVTVHDLYAAYPDFFIDIHHEQQLLRE
HDVIIFQHPLYTYSCPALLKEWLDRVLSRGFANGVDGNALEGKYWRSVVTTGEPESAFKQ
QGLNRYSLNDIMRPFELTARMCRMHWMPPMIVYMARRQSPELLKNYARAYGDWLAAPLLN
GGV