Protein Info for IAI47_02005 in Pantoea sp. MT58

Annotation: taurine ABC transporter ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 156 (140 residues), 111.6 bits, E=4.9e-36

Best Hits

Swiss-Prot: 76% identical to TAUB_ECO57: Taurine import ATP-binding protein TauB (tauB) from Escherichia coli O157:H7

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 97% identity to pva:Pvag_2912)

MetaCyc: 75% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport ATP-binding protein TauB" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Protein Sequence (255 amino acids)

>IAI47_02005 taurine ABC transporter ATP-binding subunit (Pantoea sp. MT58)
MLRIAHLHARYAGQPVLQDINLQLDSHELLVVLGPSGCGKTTLLNLVAGFLPVESGSITL
DKQPVTGPGAERGVVFQHEGLLPWRNVLDNVAFGLQLAGMSRPAREAIARKLIRQVGLEG
AEKRAIWQLSGGQRQRVGIARALATDPQLLLLDEPFGALDAFTREQMQTLLLTLWRDSGK
QILLITHDIEEAIFLASELILLSPGPGRIVERLRPGFGQRFAAGESCRSIKSDPQFIAQR
EYVLSRVFDQREAFA